Protein src2 homolog

Author: uxbk

August undefined, 2024

WebbThis protein contains N-terminal sites for myristylation and palmitoylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. WebbSRC2: 85: 1.0: 0.542: Protein Src2 Homolog: 9121: Hordeum vulgare: A0A287EUI9: Undefined: 85: 1.0: 0.812: C2 Domain-Containing Protein: 9121: Hordeum vulgare: …

A low temperature-inducible protein AtSRC2 enhances the ROS …

WebbSRC2 homolog (Fragment) (AHRD V1 *--- B3IYJ9_9SOLA); contains Interpro domain(s) IPR018029 C2 membrane targeting protein Location: ... Match: SRC2_ARATH (Protein SRC2 homolog OS=Arabidopsis thaliana GN=SRC2 PE=1 SV=1) HSP 1 Score: 229.9 bits (585), Expect = 3.4e-59 WebbProtein SRC2 homolog OS=Arabidopsis thaliana... 0.04: Archaeplastida: Gb_28884: No alias: BON-interacting Prgrammed Cell Death co-suppressor (BAP) 0.02: Archaeplastida: Gb_28889: No alias: BON-interacting Prgrammed Cell Death co-suppressor (BAP) 0.03: Archaeplastida: Gb_28891: No alias: ines hernand la resistencia

FGR/SRC2 Polyclonal Antibody (BS-13157R) - thermofisher.com

WebbCalcium-dependent lipid-binding (CaLB domain) family protein: 0.05: Archaeplastida: AT2G13350: No alias: Calcium-dependent lipid-binding (CaLB domain) family protein: 0.05: Archaeplastida: AT3G04360: No ... Protein SRC2 OS=Glycine max (sp o04133 src2_soybn : 86.3) 0.04: Archaeplastida: LOC_Os05g05650.1: No alias: Protein SRC2 OS=Glycine max … Webb19 sep. 2024 · Zhu et al. ( 2024) validated and characterized seed number per siliqua QTL qSN.A7 and demonstrated that the difference in single nucleotide polymorphisms (SNPs) between the two homologous near-isogenic lines was determined by the embryonic genotypic effect. WebbIn this study, we screened for proteins that interact with the N-terminal cytosolic region of AtRbohF by a yeast two-hybrid screen, and isolated AtSRC2, an A. thaliana homolog of … log in to my cdp account

Cla019917 (gene) Watermelon (97103) v1 Cucurbit Genomics …

InParanoiDB 9

WebbBiomolecule Binding Database. FGR Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog Proto-oncogene c-Fgr SRC SRC2 p55-Fgr p58-Fgr p58c-Fgr WebbDescription. An autosomal recessive, severe mitochondrial disorder characterized by hypotonia, global developmental delay, hypertrophic cardiomyopathy, lactic acidosis, … log in to mychart account inovaWebbSpeed is critical in responding to a novel pathogen. Our cross-functional task force is developing products, processes and infrastructure to bolster our long-term preparedness so we can get required tests to those who need them quickly. ines hernand edad

"Webbprotein SRC2 homolog. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. LOC104888396 hypothetical protein [] Gene ID: … " - Protein src2 homolog

Protein src2 homolog

A low temperature-inducible protein AtSRC2 enhances the ROS …

Webb24 dec. 2024 · A homologous trait is often called a homolog (also spelled homologue). In genetics, the term “homolog” is used both to refer to a homologous protein and to the … Webbprotein SRC2 homolog Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. LOC101259408 protein SRC2 homolog [ (tomato)]

Did you know?

Webbprotein SRC2 homolog. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. LOC104428269 protein SRC2 homolog [] Gene … WebbSRC2 / Anti-Protein SRC2 homolog Antibody Product Information Form: Lyophilized Stability & Storage: Use a manual defrost freezer and avoid repeated freeze-thaw …

WebbEPSD: Eukaryotic Phosphorylation Sites Database • Arabidopsis thaliana In Arabidopsis thaliana, there are 70,964 experimentally identified p-sites of 13,317 non-redundant proteins, including 48,827 phosphoserine, 16,978 phosphothreonine and 5,159 phosphotyrosine. WebbProtein SRC2 OS=Glycine max: 0.08: Archaeplastida: AT1G04540: No alias: Calcium-dependent lipid-binding (CaLB domain) family protein: 0.02: Archaeplastida: AT1G07310: ... Protein SRC2 homolog OS=Arabidopsis thaliana... 0.04: Archaeplastida: Gb_28884: No alias: BON-interacting Prgrammed Cell Death co-suppressor (BAP) 0.03: Archaeplastida: …

Webbgenome browser: aa seq: 272 aa aa seq db search msiqglllevrvtgcrklrdteffsrqdpyvivdyattklrtrtctdggrnpsfdekfhi plieglrelsinvwnsntintddfigscrvplnkvltsgyddsswplqtrhmksagevkl WebbThe histone deacetylase inhibitor MS-275 could deplete the expression of miR-92a-3p and upregulate MYC Binding Protein 2 ... (ceRNA) for miR-124. Western blot indicated that knockdown of HOXA11-AS downregulated enhancer of zeste homolog 2 (EZH2 ... Fiskus W, et al. miR-137 targets p160 steroid receptor coactivators SRC1, SRC2, and SRC3 ...

Webb3 okt. 2024 · In addition, we identified another lncRNA, LNC_012667, which was coexpressed with several key mRNAs , such as Csa7G430240.1 (4-coumarate: CoA ligase), Csa1G569470.1 (protein SRC2 homolog), and Csa1G701990.1 (glutathionyl …

WebbProtein SRC2 homolog OS=Arabidopsis thaliana... 0.03: Archaeplastida: MA_10432927g0010: No alias: no hits & (original description: none) 0.03: Archaeplastida: MA_18179g0010: No alias: Protein SRC2 OS=Glycine max (sp o04133 src2_soybn : 94.0) 0.06: Archaeplastida: MA_5321101g0010: No alias: Protein SRC2 homolog … ines hernandez massobrio log in to mychart account gaWebbCultivated soybean (Glycine max (L.)), the world’s most important legume crop, has high-to-moderate salt sensitivity. Being the frontier for sensing and controlling solute transport, membrane proteins could be involved in cell signaling, osmoregulation, and stress-sensing mechanisms, but their roles in abiotic stresses are still largely unknown. … log into my centurylink accountWebb11 nov. 2024 · The activation of both PRRs and NLRs leads to convergent responses, such as ion fluxes, activation of mitogen-activated protein kinase (MAPK) cascades, … ines hernand parejaWebbLOC110915711 protein SRC2 homolog [ (common sunflower)] Gene ID: 110915711, updated on 28-Aug-2024 Summary Other designations protein SRC2 homolog, putative … log into mychart account fresnoWebbSRC2_ARATH - 0.69 - - Protein SRC2 homolog NQR1_ORYSJ -0.8 Probable NADPH:quinone oxidoreductase 1 C7D55_HYOMU -0.7 Premnaspirodiene oxygenase ASMT1_ORYSJ -0.9 Acetylserotonin O-methyltransferase 1 PER2_ORYSJ 0.78 Peroxidase 2 POP3_ARATH -0.9 Stress-response A/B ... inés hernand twitterWebb; Single-pass type II membrane protein Sequence analysis Note: Binds to C-terminal sequence of alpha-TIP and moves from the ER to vacuoles. Movement is accompanied by membrane internalization, and SRC2 is present in crystalloid-like structures within … log into mychart accountkettering